PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araip.PJS9A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family G2-like
Protein Properties Length: 115aa    MW: 12514.2 Da    PI: 8.5018
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araip.PJS9AgenomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like109.32e-344094155
      G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                 kprlrWt++LHerFv+av+qLGG+ kAtPk+il++m+vkgLtl+h+kSHLQkYRl
  Araip.PJS9A 40 KPRLRWTTDLHERFVDAVTQLGGATKATPKAILRTMNVKGLTLYHLKSHLQKYRL 94
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-333795IPR009057Homeodomain-like
PROSITE profilePS5129411.0593797IPR017930Myb domain
TIGRFAMsTIGR015574.6E-254095IPR006447Myb domain, plants
SuperFamilySSF466891.15E-174096IPR009057Homeodomain-like
PfamPF002497.8E-94293IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 115 aa     Download sequence    Send to blast
MFSRLIHPRD GGGDGDGVEE MMVQGGGGGE PSLVLTSDPK PRLRWTTDLH ERFVDAVTQL  60
GGATKATPKA ILRTMNVKGL TLYHLKSHLQ KYRLGKQSGK DFDEGCKDGG FINTD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016177138.15e-68PREDICTED: myb family transcription factor APL-like isoform X1
RefseqXP_016177139.15e-68PREDICTED: myb family transcription factor APL-like isoform X2
SwissprotQ9SAK58e-36APL_ARATH; Myb family transcription factor APL
TrEMBLC6T6Z31e-53C6T6Z3_SOYBN; Putative uncharacterized protein
STRINGGLYMA20G33540.25e-52(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF66183349
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G24120.11e-40G2-like family protein